PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.L222I
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 423aa    MW: 47323.4 Da    PI: 6.9395
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.L222IgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.32.5e-52281551128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  + pGfrFhPtdeelv +yLk+k+++ +l++ e ik++diyk++PwdLpk + ++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s+ ++
  Araip.L222I  28 MLPGFRFHPTDEELVGFYLKRKIQQMPLSI-ELIKQLDIYKYDPWDLPKVAGTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSSeGS 124
                  579***************************.89***************9888999***************************************9566 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + +glkk+Lvfykgra kg+ktdW+mhe+rl
  Araip.L222I 125 KCIGLKKSLVFYKGRAAKGVKTDWMMHEFRL 155
                  77***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100557.51428182IPR003441NAC domain
SuperFamilySSF1019411.57E-5828182IPR003441NAC domain
PfamPF023651.9E-2530155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
ACFFYISTSF NSLLFLEEME GEKLDEIMLP GFRFHPTDEE LVGFYLKRKI QQMPLSIELI  60
KQLDIYKYDP WDLPKVAGTG EKEWYFYCPR DRKYRNSARP NRVTGAGFWK ATGTDRPIYS  120
SEGSKCIGLK KSLVFYKGRA AKGVKTDWMM HEFRLPSLAD SSSDKTTIPP NDSWAICRIF  180
KKTNATAQRA LSHSWVSTLP ETPTTTTNDT DHIFHFCSSN MPTMMAKKTS FMTQFCTNYT  240
SDTQIQDVAS SYKPPFININ PLLYKHFDHH HHQLPPIISN GDLISNDCLI PSSTTTPLET  300
SSNSAKPTMD FSSLLLNMSS SVLGDFAGKT SSSSSSQEGT AATATTITSS FGGGMQEHYP  360
TIPLLRQMHQ GNNNNNIGIN NNNVSAGGEE QELEKVGSIV GFPFMNIGDA WKSNMLWDTS  420
CPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-543018919171NO APICAL MERISTEM PROTEIN
1ut4_B1e-543018919171NO APICAL MERISTEM PROTEIN
1ut7_A1e-543018919171NO APICAL MERISTEM PROTEIN
1ut7_B1e-543018919171NO APICAL MERISTEM PROTEIN
3swm_A2e-543018922174NAC domain-containing protein 19
3swm_B2e-543018922174NAC domain-containing protein 19
3swm_C2e-543018922174NAC domain-containing protein 19
3swm_D2e-543018922174NAC domain-containing protein 19
3swp_A2e-543018922174NAC domain-containing protein 19
3swp_B2e-543018922174NAC domain-containing protein 19
3swp_C2e-543018922174NAC domain-containing protein 19
3swp_D2e-543018922174NAC domain-containing protein 19
4dul_A1e-543018919171NAC domain-containing protein 19
4dul_B1e-543018919171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016193688.10.0PREDICTED: putative NAC domain-containing protein 94
TrEMBLA0A151TFU21e-159A0A151TFU2_CAJCA; Putative NAC domain-containing protein 9
STRINGGLYMA02G11900.11e-154(Glycine max)
STRINGGLYMA08G41260.21e-154(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-102NAC family protein